Gnl1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Gnl1 is a putative GTP binding protein; mouse and human homologs are localized to the MHC class I region.

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: EPYTSVGYLACRIPVQALLHLRHPEAEDPSAEHPWCAWDVCEAWAEKRGY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein-like 1

Protein Size: 607

Purification: Affinity Purified

• SKU: AVIARP54748_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54748_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 309593
• Host: Rabbit