Gnl1 Antibody - C-terminal region : HRP

Gnl1 Antibody - C-terminal region : HRP
SKU
AVIARP54748_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gnl1 is a putative GTP binding protein; mouse and human homologs are localized to the MHC class I region.

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: EPYTSVGYLACRIPVQALLHLRHPEAEDPSAEHPWCAWDVCEAWAEKRGY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein-like 1

Protein Size: 607

Purification: Affinity Purified
More Information
SKU AVIARP54748_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54748_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 309593
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×