GNRH2 Antibody : FITC

GNRH2 Antibody : FITC
SKU
AVIARP55770_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Molecular Weight: 13 kDa

Peptide Sequence: Synthetic peptide located within the following region: SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Progonadoliberin-2

Protein Size: 120

Purification: Affinity Purified
More Information
SKU AVIARP55770_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55770_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Immunohistochemistry
Human Gene ID 2797
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×