GPD1L Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPD1L

Key Reference: London,B., (2007) Circulation 116 (20), 2260-2268

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glycerol-3-phosphate dehydrogenase 1-like protein

Protein Size: 351

Purification: Affinity Purified

• SKU: AVIARP55177_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55177_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23171
• Host: Rabbit