GPS1 Antibody - N-terminal region : FITC

GPS1 Antibody - N-terminal region : FITC
SKU
AVIARP58000_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. It shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPS1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: PLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: COP9 signalosome complex subunit 1

Protein Size: 491

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP58000_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58000_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2873
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×