GRIPAP1 Antibody - N-terminal region : Biotin

GRIPAP1 Antibody - N-terminal region : Biotin
SKU
AVIARP57358_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIPAP1

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GRIP1-associated protein 1

Protein Size: 841

Purification: Affinity Purified
More Information
SKU AVIARP57358_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57358_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56850
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×