GSPT2 Antibody - middle region : FITC

GSPT2 Antibody - middle region : FITC
SKU
AVIARP55357_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSPT2

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic peptide chain release factor GTP-binding subunit ERF3B

Protein Size: 628

Purification: Affinity Purified

Subunit: ERF3B
More Information
SKU AVIARP55357_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55357_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23708
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×