GSTK1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSTK1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutathione S-transferase kappa 1

Protein Size: 226

Purification: Affinity Purified

• SKU: AVIARP55335_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55335_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 373156
• Host: Rabbit