Uniprot: P09211
Gene Name: GSTP1
Immunogen: Recombinant human GSTP1
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 85%
Core Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 83%, Cynomolgus monkey - 97%
Alternative gene names: FAEES3;GST3
Alternative protein names: Glutathione S-transferase P; GST class-pi; GSTP1-1
Protein name: Glutathione S-transferase pi 1
Clone No.: K52024_1H2
Antigen Species: Human
Target Name: GSTP1
IHC Verification: -
IHC Dilution: N/A
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-592
Cross reactivity: Not tested