GSTP1 Antibody

Uniprot: P09211

Gene Name: GSTP1

Immunogen: Recombinant human GSTP1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 85%

Core Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: FAEES3；GST3

Alternative protein names: Glutathione S-transferase P; GST class-pi; GSTP1-1

Protein name: Glutathione S-transferase pi 1

Clone No.: K52024_4C1

Antigen Species: Human

Target Name: GSTP1

IHC Verification: Fail (Liver)

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-592

Cross reactivity: Not tested

• SKU: ASBKC-1008-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-1008-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation, Western Blotting
• Isotype: IgG2a
• Human Gene ID: 2950
• Host: Mouse
• Conjugate: Unconjugated