Gtf3c5 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Gtf3c5

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: IRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: General transcription factor IIIC, polypeptide 5 EMBL AAI29110.1

Protein Size: 515

Purification: Affinity Purified

• SKU: AVIARP57923_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57923_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 362095
• Host: Rabbit