Gtpbp4 Antibody - C-terminal region : HRP

Gtpbp4 Antibody - C-terminal region : HRP
SKU
AVIARP54883_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gtpbp4 may be involved in GTP-mediated signaling associated with cell proliferation and renal function.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gtpbp4

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleolar GTP-binding protein 1 PIRNR PIRNR038919

Protein Size: 636

Purification: Affinity Purified
More Information
SKU AVIARP54883_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54883_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 114300
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×