HCFC1R1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HCFC1R1

Key Reference: Mahajan,S.S., (2002) J. Biol. Chem. 277 (46), 44292-44299

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Host cell factor C1 regulator 1

Protein Size: 138

Purification: Affinity Purified

• SKU: AVIARP56149_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56149_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54985
• Host: Rabbit