HDDC3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDDC3

Key Reference: Zody,M.C., (2006) Nature 440 (7084), 671-675

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

Protein Size: 140

Purification: Affinity Purified

• SKU: AVIARP55898_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55898_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 374659
• Host: Rabbit