HEPACAM Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEPACAM

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hepatocyte cell adhesion molecule

Protein Size: 416

Purification: Affinity Purified

• SKU: AVIARP55504_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55504_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 220296
• Host: Rabbit