HEXIM1 Antibody

Uniprot: O94992

Gene Name: HEXIM1

Immunogen: Recombinant human HEXIM1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 96%

Core Sequence: WGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLL

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: CLP1；EDG1；HIS1；MAQ1

Alternative protein names: Protein HEXIM1; Cardiac lineage protein 1; Estrogen down-regulated gene 1 protein; Hexamethylene bis-acetamide-inducible protein 1; Menage a quatre protein 1

Protein name: HEXIM P-TEFb complex subunit 1

Clone No.: K40046_17C2

Antigen Species: Human

Target Name: HEXIM1

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-712

Cross reactivity: Not tested

• SKU: ASBKC-1005-50
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-1005-50
• Package Unit: 50 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG2a
• Human Gene ID: 10614
• Host: Mouse
• Conjugate: Unconjugated