HIKESHI Antibody - middle region : HRP

HIKESHI Antibody - middle region : HRP
SKU
AVIARP56903_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but not the ADP form of Hsp70 proteins under conditions of heat shock stress. Structural analyses demonstrate that the protein forms an asymmetric homodimer and that the N-terminal domain consists of a jelly-roll/beta-sandwich fold structure that contains hydrophobic pockets involved in FG-nucleoporin recognition. Reduction of RNA expression levels in HeLa cells using small interfering RNAs results in inhibition of heat shock-induced nuclear accumulation of Hsp70s, indicating a role for this gene in regulation of Hsp70 nuclear import during heat shock stress.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf73

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: protein Hikeshi

Protein Size: 197

Purification: Affinity Purified
More Information
SKU AVIARP56903_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56903_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51501
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×