HINT1 Antibody - N-terminal region : Biotin

HINT1 Antibody - N-terminal region : Biotin
SKU
AVIARP54766_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1

Key Reference: Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histidine triad nucleotide-binding protein 1

Protein Size: 126

Purification: Affinity Purified
More Information
SKU AVIARP54766_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54766_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3094
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×