HINT1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1

Key Reference: Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histidine triad nucleotide-binding protein 1

Protein Size: 126

Purification: Affinity Purified

• SKU: AVIARP54767_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54767_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 3094
• Host: Rabbit