HIRIP3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIRIP3

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HIRA-interacting protein 3

Protein Size: 556

Purification: Affinity Purified

• SKU: AVIARP58286_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58286_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8479
• Host: Rabbit