Hmgn2 Antibody - N-terminal region : FITC

Hmgn2 Antibody - N-terminal region : FITC
SKU
AVIARP58365_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Hmgn2 bind to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may be involved in the process which maintains transcribable genes in an unique chromatin conformation.

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-histone chromosomal protein HMG-17

Protein Size: 90

Purification: Affinity Purified
More Information
SKU AVIARP58365_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58365_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 15331
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×