HNRNPK Antibody

HNRNPK Antibody
SKU
ASBKC-1020-100
Packaging Unit
100 μl
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Uniprot: P61978

Gene Name: HNRNPK

Immunogen: Recombinant human HNRNPK

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 100%

Core Sequence: PNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HNRPK

Alternative protein names: Heterogeneous nuclear ribonucleoprotein K; hnRNP K; Transformation up-regulated nuclear protein; TUNP

Protein name: Heterogeneous nuclear ribonucleoprotein K

Clone No.: K06321_10G7

Antigen Species: Human

Target Name: HNRNPK

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-333

Cross reactivity: Not tested
More Information
SKU ASBKC-1020-100
Manufacturer Absea Biotechnology
Manufacturer SKU KC-1020-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Western Blotting
Isotype IgG1
Human Gene ID 3190
Host Mouse
Conjugate Unconjugated
Product information (PDF)
×
MSDS (PDF)
×