Uniprot: P61978
Gene Name: HNRNPK
Immunogen: Recombinant human HNRNPK
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 100%
Core Sequence: PNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: HNRPK
Alternative protein names: Heterogeneous nuclear ribonucleoprotein K; hnRNP K; Transformation up-regulated nuclear protein; TUNP
Protein name: Heterogeneous nuclear ribonucleoprotein K
Clone No.: K06321_10G7
Antigen Species: Human
Target Name: HNRNPK
IHC Verification: -
IHC Dilution: N/A
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-333
Cross reactivity: Not tested
English
Deutsch
