HOM-TES-103 Antibody - C-terminal region : FITC

HOM-TES-103 Antibody - C-terminal region : FITC
SKU
AVIARP55421_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOM-TES-103

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 200

Purification: Affinity Purified
More Information
SKU AVIARP55421_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55421_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25900
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×