HOXD12 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters,

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXD12

Key Reference: 0

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: AELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Hox-D12

Protein Size: 279

Purification: Affinity Purified

• SKU: AVIARP58025_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58025_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3238
• Host: Rabbit