HS1BP3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HS1BP3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HCLS1-binding protein 3

Protein Size: 392

Purification: Affinity Purified

• SKU: AVIARP57633_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57633_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64342
• Host: Rabbit