Hsp90ab1 Antibody - N-terminal region : Biotin

Hsp90ab1 Antibody - N-terminal region : Biotin
SKU
AVIARP58844_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Hsp90ab1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock protein HSP 90-beta

Protein Size: 724

Purification: Affinity Purified
More Information
SKU AVIARP58844_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58844_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 15516
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×