HSPB8 Antibody - middle region : FITC

HSPB8 Antibody - middle region : FITC
SKU
AVIARP55036_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPB8

Molecular Weight: 21

Peptide Sequence: Synthetic peptide located within the following region: PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock protein beta-8

Protein Size: 196

Purification: Affinity Purified
More Information
SKU AVIARP55036_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55036_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26353
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×