Hspbp1 Antibody - C-terminal region : Biotin

Hspbp1 Antibody - C-terminal region : Biotin
SKU
AVIARP54869_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Hspbp1 inhibits chaperone activity by preventing ATP binding.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hsp70-binding protein 1

Protein Size: 357

Purification: Affinity Purified
More Information
SKU AVIARP54869_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54869_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 246146
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×