HSPC111 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Key Reference: Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleolar protein 16

Protein Size: 178

Purification: Affinity Purified

• SKU: AVIARP56898_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56898_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51491
• Host: Rabbit