HYLS1 Antibody - middle region : FITC

HYLS1 Antibody - middle region : FITC
SKU
AVIARP55449_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HYLS1

Key Reference: Mee,L., (2005) Hum. Mol. Genet. 14 (11), 1475-1488

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydrolethalus syndrome protein 1

Protein Size: 299

Purification: Affinity Purified
More Information
SKU AVIARP55449_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55449_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219844
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×