ICA1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ICA1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Islet cell autoantigen 1

Protein Size: 483

Purification: Affinity Purified

• SKU: AVIARP54742_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54742_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 3382
• Host: Rabbit