IER5L Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IER5L

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Immediate early response gene 5-like protein

Protein Size: 404

Purification: Affinity Purified

• SKU: AVIARP55970_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55970_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 389792
• Host: Rabbit