Ift80 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Ift80 is a component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Intraflagellar transport protein 80 homolog

Protein Size: 777

Purification: Affinity Purified

• SKU: AVIARP57456_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57456_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 68259
• Host: Rabbit