IL7R Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL7R

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-7 receptor subunit alpha

Protein Size: 459

Purification: Affinity Purified

Subunit: alpha

• SKU: AVIARP59084_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59084_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3575
• Host: Rabbit