Uniprot: P10145
Gene Name: CXCL8
Immunogen: Recombinant human CXCL8
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 53%
Core Sequence: ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%
Alternative gene names: IL8
Alternative protein names: Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8)77; GCP/IL-8 protein II; IL-8(1-77); IL8/NAP1 form II; MDNCF-b; IL-8(5-77; IL-8(6-77; (Ser-IL-8)72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8(7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8(8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8(9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]
Protein name: C-X-C motif chemokine ligand 8
Product panel: Cytokines
Clone No.: K06289_9F3
Antigen Species: Human
Target Name: CXCL8
IHC Verification: succeed
IHC Dilution: 1:250~1:500
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: succeed
Sandwich ELISA Dilution: 1:250~1:500
Antigen ID: PP-530
Cross reactivity: Not tested
English
Deutsch
