Impa2 Antibody - C-terminal region : FITC

Impa2 Antibody - C-terminal region : FITC
SKU
AVIARP58230_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Impa2 can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Impa2 has been implicated as the pharmacological target for lithium Li+ action in brain.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Impa2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 2

Protein Size: 290

Purification: Affinity Purified
More Information
SKU AVIARP58230_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58230_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 114663
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×