INPP5B Antibody - middle region : FITC

INPP5B Antibody - middle region : FITC
SKU
AVIARP54772_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). This gene encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INPP5B

Key Reference: Williams,C., J. Cell. Sci. 120 (PT 22), 3941-3951 (2007)

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Type II inositol 1,4,5-trisphosphate 5-phosphatase

Protein Size: 913

Purification: Affinity Purified
More Information
SKU AVIARP54772_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54772_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3633
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×