ISY1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ISY1 may play a role in pre-mRNA splicing (Potential).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISY1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 307

Purification: Affinity Purified

• SKU: AVIARP57838_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57838_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57461
• Host: Rabbit