ITGB3BP Antibody - N-terminal region : FITC

ITGB3BP Antibody - N-terminal region : FITC
SKU
AVIARP55000_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITGB3BP

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein R

Protein Size: 216

Purification: Affinity Purified
More Information
SKU AVIARP55000_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55000_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23421
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×