KCTD16 Antibody - N-terminal region : Biotin

KCTD16 Antibody - N-terminal region : Biotin
SKU
AVIARP57447_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD16

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BTB/POZ domain-containing protein KCTD16

Protein Size: 428

Purification: Affinity Purified
More Information
SKU AVIARP57447_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57447_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57528
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×