KIAA0692 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0692

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat and LEM domain-containing protein 2

Protein Size: 938

Purification: Affinity Purified

• SKU: AVIARP55170_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55170_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23141
• Host: Rabbit