KLHL9 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of c

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL9

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kelch-like protein 9

Protein Size: 617

Purification: Affinity Purified

• SKU: AVIARP57295_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57295_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55958
• Host: Rabbit