KRT84 Antibody - middle region : HRP

KRT84 Antibody - middle region : HRP
SKU
AVIARP55404_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT84

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Keratin, type II cuticular Hb4

Protein Size: 600

Purification: Affinity Purified
More Information
SKU AVIARP55404_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55404_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3890
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×