LAX1 Antibody - C-terminal region : Biotin

LAX1 Antibody - C-terminal region : Biotin
SKU
AVIARP59140_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAX1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ55255, highly similar to Lymphocyte transmembrane adapter 1 EMBL BAH13480.1

Protein Size: 382

Purification: Affinity Purified
More Information
SKU AVIARP59140_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59140_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54900
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×