LIN37 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein expressed in the eye.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIN37

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein lin-37 homolog

Protein Size: 246

Purification: Affinity Purified

• SKU: AVIARP57335_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57335_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55957
• Host: Rabbit