LRRC20 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRC20

Key Reference: N/A

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MLKKMGEAVARVARKVNETVESGSDTLELHLEGNFLHRLPSEVSALQHLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: leucine-rich repeat-containing protein 20

Protein Size: 134

Purification: Affinity purified

• SKU: AVIARP57171_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57171_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55222
• Host: Rabbit