LRRC37A3 Antibody - middle region : HRP

LRRC37A3 Antibody - middle region : HRP
SKU
AVIARP56070_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC37A3

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 180kDa

Peptide Sequence: Synthetic peptide located within the following region: NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 37A3

Protein Size: 1634

Purification: Affinity Purified
More Information
SKU AVIARP56070_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56070_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 374819
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×