LRRC51 Antibody - N-terminal region : FITC

LRRC51 Antibody - N-terminal region : FITC
SKU
AVIARP55466_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of LRRC51 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC51

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 51

Protein Size: 192

Purification: Affinity Purified
More Information
SKU AVIARP55466_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55466_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 220074
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×