LRRC75B Antibody - middle region : Biotin

LRRC75B Antibody - middle region : Biotin
SKU
AVIARP56011_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf36

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: leucine-rich repeat-containing protein 75B

Protein Size: 315

Purification: Affinity Purified
More Information
SKU AVIARP56011_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56011_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 388886
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×